PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa20g016720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HB-other
Protein Properties Length: 362aa    MW: 40070.2 Da    PI: 4.4643
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa20g016720.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.21.4e-08299346653
                     S--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHH CS
        Homeobox   6 tftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRa 53 
                     + +k  +e+Le+++++++ p+ +    + + ++L+ ++V  WF  +Ra
  Csa20g016720.1 299 RVKKAHIETLEKVYRRSKRPTNAVVSSIVQVTNLPRKRVLKWFEDKRA 346
                     567899*****************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.669291351IPR001356Homeobox domain
SuperFamilySSF466896.42E-8296351IPR009057Homeodomain-like
SMARTSM003897.8E-4297355IPR001356Homeobox domain
PfamPF000464.7E-6299346IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.6E-7299357IPR009057Homeodomain-like
CDDcd000861.66E-5302346No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0002229Biological Processdefense response to oomycetes
GO:0009414Biological Processresponse to water deprivation
GO:0009682Biological Processinduced systemic resistance
GO:0009787Biological Processregulation of abscisic acid-activated signaling pathway
GO:0010118Biological Processstomatal movement
GO:0050832Biological Processdefense response to fungus
GO:2000022Biological Processregulation of jasmonic acid mediated signaling pathway
GO:2000071Biological Processregulation of defense response by callose deposition
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MAVALSSSSG VVSHLLPPSF SSSSGVSVNR VLFRNRKSSP CSLSLPFHSP TPRSVLVFAR  60
GKNRKGFASS SSPSSPKKNK KKSFERDNNG GSEEEDDPFE ALFNLLEEDL KNDNSSIDDE  120
EISEEELNAL ADELARVLGG GDDDDDAIDL FGSATADVVD DQDENEDEDD NNDDDDEDDD  180
DSEEEDERPT KLKNWQLRRL AYALKAGRRK TSIKNLAAEV CLDRAYVLEL LRDPPPKLLM  240
LSATLPDEKP PVAAPENSSP DPTPVESSSA EEDVVVEPVE KVKDEAVHVM QQRWSAQKRV  300
KKAHIETLEK VYRRSKRPTN AVVSSIVQVT NLPRKRVLKW FEDKRAEDGV PDKRAPYQAP  360
V*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0020170.0BT002017.1 Arabidopsis thaliana putative protein (At5g11270) mRNA, complete cds.
GenBankBT0087430.0BT008743.1 Arabidopsis thaliana At5g11270 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010491848.10.0PREDICTED: protein BFR2-like
SwissprotQ8H0V51e-159OCP3_ARATH; Protein OVEREXPRESSOR OF CATIONIC PEROXIDASE 3
TrEMBLD7M3N91e-175D7M3N9_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.6__1093__AT5G11270.11e-174(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM120772631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11270.11e-124overexpressor of cationic peroxidase 3